메뉴열기

The Professional Protein Company
LUGEN SCI
Tel. : 02-3666-4111
Fax. : 02-3666-1117
E-mail : Lugen@Lugensci.com

루젠에스씨아이의 기술력과 노하우로 연구자분들의 동반자가 되겠습니다.

하단에 상세영역별 카테고리를 눌르시면 보다 쉽게 원하는 제품을 찾을수 있습니다. We will be your companion with our high technology and sufficent Know -how. If press below, You could easily find out several kinds of related informations.


카테고리 Plant Derived Peptide
CAT.NO
Product NtRALF
Size
Price

Product name: NtRALF

Synonyms: Rapid alkalinization factor,RALF,

Sequence: ATKKYISYGALQKNSVPCSRRGASYYNCKPGAQANPYSRGCSAITRCRS

Modifications: disulfide(1-2,3-4),

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Rapid Alkalinization Factor (RALF) is a 49-amino acid peptide initially isolated from tobacco leaves that is capable of arresting both root and pollen tube growth. With suspension cells, addition of RALF causes an elevation of the pH of the extracellular media, caused by the blockage of a proton pump. RALF associates with a putative receptor(s) on the surface of the plant cell, initiating a signal transduction pathway.

Uniprot ID: Q945T0

 

Usage: For Scientific Research Use Only, Not for Human Use.

 

Reference:

 

Handbook of Biologically Active Peptides (Second Edition), 2013, Pages 46-49.

Peptides, Volume 31, Issue 11, November 2010, Pages 1973-1977.


메뉴닫기

견적문의

INQUIRY

아래 항목에 맞게 정확히 입력하여 주십시오.