Product name: Peptide POLARIS

Synonyms: Protein expressed in embryo 101,AtEM101,

Sequence: MKPRLCFNFRRRSISPCYISISYLLVAKLFKLFKIH

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: The POLARIS (PLS) peptide was identified in the plant species Arabidopsis thaliana by promoter trapping. Recent results show a role for PLS in repressing ethylene responses, and in promoting ethylene-mediated auxin biosynthesis.

Uniprot ID: Q8LLV8

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Handbook of Biologically Active Peptides (Second Edition), 2013, Pages 40-45.

Comparative Biochemistry and Physiology Part A: Molecular & Integrative Physiology, Volume 150, Issue 3, Supplement, July 2008, Pages S195-S196.