메뉴열기

The Professional Protein Company
LUGEN SCI
Tel. : 02-3666-4111
Fax. : 02-3666-1117
E-mail : Lugen@Lugensci.com

루젠에스씨아이의 기술력과 노하우로 연구자분들의 동반자가 되겠습니다.

하단에 상세영역별 카테고리를 눌르시면 보다 쉽게 원하는 제품을 찾을수 있습니다. We will be your companion with our high technology and sufficent Know -how. If press below, You could easily find out several kinds of related informations.


카테고리 Plant Derived Peptide
CAT.NO
Product Peptide POLARIS
Size
Price

Product name: Peptide POLARIS

Synonyms: Protein expressed in embryo 101,AtEM101,

Sequence: MKPRLCFNFRRRSISPCYISISYLLVAKLFKLFKIH

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: The POLARIS (PLS) peptide was identified in the plant species Arabidopsis thaliana by promoter trapping. Recent results show a role for PLS in repressing ethylene responses, and in promoting ethylene-mediated auxin biosynthesis.

Uniprot ID: Q8LLV8

 

Usage: For Scientific Research Use Only, Not for Human Use.

 

Reference:

Handbook of Biologically Active Peptides (Second Edition), 2013, Pages 40-45.

Comparative Biochemistry and Physiology Part A: Molecular & Integrative Physiology, Volume 150, Issue 3, Supplement, July 2008, Pages S195-S196.


메뉴닫기

견적문의

INQUIRY

아래 항목에 맞게 정확히 입력하여 주십시오.