Product name: Growth hormone-releasing factor

Synonyms:,GRF, , Somatoliberin GHRH,Somatocrinin,Somatorelin, Growth hormone-releasing hormone

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Modifications: c-terminal amide

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Growth hormone-releasing hormone (GHRH) is a hypothalamic peptide that regulates the secretion of GH from the pituitary by an action exerted on the hypophyseal receptors for GHRH. GHRH, in addition to stimulating GH secretion from the pituitary, exerts survival and antiapoptotic effects in different cell types. Moreover, we and others have recently shown that GHRH displays antiapoptotic effects in isolated cardiac myocytes and protects the isolated heart from ischemia/reperfusion injury and myocardial infarction in vivo.

Uniprot ID: P01286

Compound ID: 44134750

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Endocrinology. 2015 Sep;156(9):3239-52.

Endokrynol Pol. 2015;66(2):137-41.

Gen Comp Endocrinol. 2014 Apr 1;199:38-45.

Endocrinology. 2013 Apr;154(4):1624-35.

Eur J Endocrinol. 2005 Apr; 152(4):575-80.

Proc Natl Acad Sci U S A. 2004 Feb 10;101(6):1708-13.

Ann Oncol. 2001; 12 Suppl 2:S89-94.

Acta Paediatr Scand Suppl. 1987; 331:42-7.