Product name: Tracheal antimicrobial peptide

Sequence: NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK

Modifications: disulfide(1-5,2-4,3-6)

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Tracheal antimicrobial peptide (TAP) is a β-defensin produced by mucosal epithelial cells of cattle.

Uniprot ID: P25068

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Veterinary Immunology and Immunopathology, Volume 152, Issues 3–4, 15 April 2013, Pages 289-294.