Product name: Termicin

Sequence: ACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG

Modifications: disulfide(1-4,2-5,3-6),c-terminal amide,

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Termicin is a cysteine-rich antifungal peptide also exhibiting a weak antibacterial activity. The antifungal properties of termicin may be related to its marked hydrophobicity and its amphipatic structure as compared to the antibacterial defensins.

Uniprot ID: P82321

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Protein Sci. 2003 Mar;12(3):438-46.