Product name: Plectasin

Sequence: GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY

Modifications: disulfide(1-4,2-5,3-6),

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Plectasin has specific antibacterial activity against Streptococcus pneumoniae. Plectasin showed no cytotoxicity to A549 cells, normal human bronchial epithelial cells, or lung fibroblasts. The intracellular activity of plectasin, an antimicrobial peptide, against S. aureus was determined both in vitro and in vivo.

Uniprot ID: Q53I06

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

OMICS. 2013 Nov;17(11):560-7.

Protein Expr Purif. 2011 Aug;78(2):189-96.

Pharm Unserer Zeit. 2010 Sep;39(5):336-8.

Science. 2010 May 28;328(5982):1168-72.

Antimicrob Agents Chemother. 2009 Nov;53(11):4801-8.

Antimicrob Agents Chemother. 2009 Nov;53(11):4794-800.

Biochem Biophys Res Commun. 2008 Oct 3;374(4):709-13.

Nature. 2005 Oct 13; 437(7061):975-80.