Product name: Penaeidin-4d

Sequence: HSSGYTRPLRKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHL

Modifications: c-terminal amide,disulfide(1-3,2-5,4-6),

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Pen4-1 proved to be an effective antimicrobial peptide, particularly against the broad-spectrum pathogen Fusarium oxysporum, exhibiting a complex effect on reproductive growth at inhibitory concentrations resulting in the suppression of spore formation. Pen4-1 exhibits unique features [not previously observed for penaeidins from the Pacific white shrimp (L. vannamei)], including target-species specificity against Gram-positive bacteria, indicating a potential partitioning of antimicrobial function among this family of peptides.

Uniprot ID: Q962A7

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Biochem J. 2004 Jul 1;381(Pt 1):79-86.