Product name: Pardaxin P-5

Sequence: GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Pardaxin, a 33-amino-acid pore-forming polypeptide toxin isolated from the Red Sea Moses sole Pardachirus marmoratus, has a helix-hinge-helix structure. This is a common structural motif found both in antibacterial peptides that can act selectively on bacterial membranes (e.g., cecropin), and in cytotoxic peptides that can lyse both mammalian and bacterial cells (e.g., melittin).

Uniprot ID: P81862

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

J Biol Chem. 1991 Dec 15; 266(35):23769-75.

J Biol Chem. 1992 Apr 5; 267(10):6502-9.

Eur J Biochem. 1996 Apr 1;237(1):303-10.