Product name: Parabutoporin

Sequence: FKLGSFLKKAWKSKLAKKLRAKGKEMLKDYAKGLLEGGSEEVPGQ

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: At micromolar concentrations it has antimicrobial effects against G+ and G- bacteria and is antifungal as well. However, at submicromolar concentrations, parabutoporin also directly interferes with cellular functions of the human innate immune system, especially polymorphonuclear neutrophils (PMN): parabutoporin acts as a chemoattractant for neutrophils, induces their degranulation, while delaying constitutive neutrophil apoptosis.

Uniprot ID: P83312

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Toxicon. 2010 Feb-Mar;55(2-3):180-5.

J Leukoc Biol. 2009 Mar;85(3):497-507.

FEBS Lett. 2006 Nov 13;580(26):6206-10.

Peptides. 2004 Jul;25(7):1079-84.