Product name: Myticin C

Sequence: QSVACRSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Myticin C (Myt C) is a highly variable host-defense peptide (HDP) associated to the immune response in the mediterranean mussel (Mytilus galloprovincialis), which has shown to be active across species due to its strong antiviral activity against a fish rhabdovirus found in fish cells overexpressing this HDP.

Uniprot ID: A7DWU7

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

PLoS One. 2011; 6(8):e23140.

Peptides. 2008 Jul; 29(7):1094-101.