Product name: Murine beta-defensin 2

Sequence: AVGSLKSIGYEAELDHCHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYMK

Modifications: disulfide(1-5,2-4,3-6)

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Murine beta-defensin 2 (Mbd2), a small molecular weight protein expressed by epithelial cells, has been shown to enhance antigen-specific immune responses by recruiting and activating professional antigen presenting cells to the site of vaccination.

Uniprot ID: P82020

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Virus Research, Volume 177, Issue 1, October 2013, Pages 55-61.

Virus Research, Volume 178, Issue 2, 26 December 2013, Pages 398-403.