Product name: Lingual antimicrobial peptide

Sequence: VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK

Modifications: disulfide(1-5,2-4,3-6)

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Lingual antimicrobial peptide (LAP), a member of the beta-defensin family in cows, is involved in the innate immune system and plays a crucial role in killing a large variety of microorganisms.

Uniprot ID: Q28880

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Anim Sci J. 2009 Aug;80(4):446-50.

Mol Immunol. 2011 Mar;48(6-7):895-908.

Vet Immunol Immunopathol. 2011 Jul 15;142(1-2):87-94.

Immunogenetics. 2011 Nov;63(11):715-25.

Vet Immunol Immunopathol. 2012 Jan 15;145(1-2):499-504.

Anim Sci J. 2013 Nov;84(11):751-6.