Product name: hBD-1

Sequence: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Modifications: disulfide(1-5,2-4,3-6)

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Human β-defensin 1 (hBD-1) is probably the most important antimicrobial peptide in epithelial tissues.hBD-1 is a tumor suppressor and DEFB1 is the only innate immunity gene that shows long-term balanced selection and heterozygote advantage.

Uniprot ID: P60022

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Molecular Immunology, Volume 45, Issue 3, February 2008, Pages 839-848.

The International Journal of Biochemistry & Cell Biology, Volume 42, Issue 6, June 2010, Pages 800-804.