Product name: Centrocin 2

Sequence:

SWFSRTVHNVGNAVRKGIHAGQGVCSGLGL(heavy chain)

DLRAICAGAHAL(light chain)

Modifications: brominated tryptophan(2,heavy chain),interchain disulfide,

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Centrocins 1 (4.5 kDa) and 2 (4.4 kDa), purified from coelomocyte extracts of the green sea urchin, Strongylocentrotus droebachiensis. The native peptides are cationic and show potent activities against Gram-positive and Gram-negative bacteria.

Uniprot ID: D8WN04

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Developmental & Comparative Immunology.Volume 34, Issue 9, September 2010, Pages 959–968.