Product name: Cholecystokinin-33

Synonyms: CCK33,CCK-33,

Sequence: KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF

Modifications: Y27 sulfation,

Purity: 95% by HPLC

Counter ion: sulfate

Format: Lyophilized powder

Description: Cholecystokinin (CCK) controls nutrient delivery to the small intestine by inhibiting food intake and gastric emptying.

Uniprot ID: P06307

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Australas Radiol. 1994 Feb; 38(1):30-3.

Semin Nucl Med. 1996 Jan; 26(1):16-24.

Obes Rev. 2005 Nov; 6(4):297-306.

Curr Opin Endocrinol Diabetes Obes. 2012 Feb;19(1):8-12.

J Am Coll Surg. 2013 Aug;217(2):317-23.