´ëÇѹα¹ ¿¬±¸ÀںеéÀÇ µ¿¹ÝÀÚ°¡ µÇ°Ú½À´Ï´Ù. ´Ù¾çÇÑ ÆéŸÀÌµå ¶óÀ̺귯¸® Á¤º¸¸¦ °øÀ¯µå¸³´Ï´Ù.

ÇÏ´Ü¿¡ »ó¼¼¿µ¿ªº° Ä«Å×°í¸®¸¦ ´­¸£½Ã¸é º¸´Ù ½±°Ô ¿øÇÏ´Â Á¦Ç°À» ãÀ»¼ö ÀÖ½À´Ï´Ù. We will be your companion with our high technology and sufficent Know -how. If press below, You could easily find out several kinds of related informations.


Ä«Å×°í¸® Gastrointestinal Hormone
CAT.NO
PRODUCT Big gastrin
Size
Price

Product name: Big gastrin

Synonyms: Gastrin component II,Gastrin-34,G34,

Sequence: QLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF

Modifications: n-terminal Pyr,c-terminal amide

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Gastrin is a hormone produced primarily by G-cells in the stomach, where it functions to stimulate acid secretion by gastric parietal cells. Gastrin is expressed in the embryonic pancreas and is common in islet cell tumors.

Uniprot ID: P01350

Usage: For Scientific Research Use Only, Not for Human Use.

 

Reference:

Digestion. 1990;47 Suppl 1:11-6; discussion 49-52. Review.

PLoS One. 2013 Aug 5;8(8):e70397.

Biomark Med. 2014 Apr;8(4):571-80.

÷ºÎÆÄÀÏ

¸Þ´º´Ý±â

°ßÀû¹®ÀÇ

INQUIRY

¾Æ·¡ Ç׸ñ¿¡ ¸Â°Ô Á¤È®È÷ ÀÔ·ÂÇÏ¿© ÁֽʽÿÀ.