Product name: urodilatin

Sequence: TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY

Modifications: disulfide(11-27),

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: urodilatin stimulates extraneuronal dopamine uptake in external renal cortex by activation of the type A natriuretic peptide receptor, coupled to cyclic guanylate monophosphate signaling and protein kinase G. Moreover, urodilatin enhances dopamine-induced inhibition of Na+, K+-ATPase activity in renal tubules.

Uniprot ID: P01160

Drug Bank ID: http://www.drugbank.ca/drugs/DB05034

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Histochem Cell Biol. 1998 Oct; 110(4):335-57.

Am Heart J. 2005 Dec; 150(6):1239.

Curr Heart Fail Rep. 2007 Sep; 4(3):147-52.