Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Modifications: disulfide(10-26),

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Measurements of cardiac troponins or brain-type natriuretic peptide (BNP) and its precursor, N-terminal brain-type natriuretic peptide (NT-proBNP), have become indispensable in the evaluation of patients with acute coronary syndromes and heart failure, respectively, constituting an integral part of the diagnostic algorithm and risk stratification of these conditions.

Uniprot ID: P16860

Drug Bank ID: http://www.drugbank.ca/drugs/DB04899

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Pediatrics. 2004 Nov; 114(5):1297-304.

J Am Coll Cardiol. 2008 Jul 22; 52(4):266-72.

JAMA. 2013 Jul 3;310(1):66-74.

Hemodial Int. 2013 Jul; 17(3):406-12.

J Trauma Acute Care Surg. 2013 Nov;75(5):813-8.