Product name: hGHRH(1-29)NH2

Synonyms: growth hormone releasing factor 1–29 NH2, Sermorelin,Sermorelina, Sermoreline, Sermorelinum,

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Modifications: C-terminal amide

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Sermorelin is a well tolerated analogue of GHRH which is suitable for use as a provocative test of growth hormone deficiency when given as a single intravenous 1 microg/kg bodyweight dose in conjunction with conventional tests. Limited data suggest that once daily subcutaneous sermorelin 30 microg/kg bodyweight is effective in promoting growth in some prepubertal children with idiopathic growth hormone deficiency.

Uniprot ID: P01286

Compound ID: 16129620

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Clin Interv Aging. 2006; 1(4):307-8.

BioDrugs. 1999 Aug; 12(2):139-57.